PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_9381481g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 319aa    MW: 35795.1 Da    PI: 5.9878
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_9381481g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.82.9e-142267146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +g+WT e+d +l ++++++G g+W+ +a+  g++Rt+ +c++rw +
  MA_9381481g0010 22 KGPWTVEDDMQLMEYIRLHGQGCWSFVAKGAGLKRTGRSCRLRWVN 67
                     79******************************************87 PP

2Myb_DNA-binding43.95.6e-1475118146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r + T+eE+ l+++++ ++G++ W+ Ia  ++ gRt++++k++w++
  MA_9381481g0010  75 RSKITPEEERLIIELHDRWGNR-WSHIAWSLP-GRTDNEIKNYWRT 118
                      6788******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.8171769IPR017930Myb domain
SuperFamilySSF466895.47E-2821116IPR009057Homeodomain-like
SMARTSM007174.7E-132171IPR001005SANT/Myb domain
PfamPF002492.0E-132267IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-202376IPR009057Homeodomain-like
CDDcd001677.08E-102469No hitNo description
PROSITE profilePS5129422.50570124IPR017930Myb domain
SMARTSM007179.6E-1274122IPR001005SANT/Myb domain
PfamPF002491.1E-1276118IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-2177124IPR009057Homeodomain-like
CDDcd001671.92E-1079118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MATRIWSGAS VVEDEDGEET RKGPWTVEDD MQLMEYIRLH GQGCWSFVAK GAGLKRTGRS  60
CRLRWVNSLR PGLKRSKITP EEERLIIELH DRWGNRWSHI AWSLPGRTDN EIKNYWRTRI  120
KGKLNLKIQR SGGIDVDIPV HFERSRRSDC LPTSSQRPPD RDGAELLTSF PTQSTEDAAV  180
QINKTQYLQD DIPPQVIPIH EVNDGYVLQG EIRHGPSQTN DDGQPGAASQ QDLKDSANQV  240
FENSSPYNFP VGSLASLLYS SEYCADGAAQ GGISLPSSSY MVASPEAFSD SEVYSNLIRM  300
YCGAWMKKMT VSIGIIWLT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-26221257109B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotP813913e-48MYB05_ANTMA; Myb-related protein 305
TrEMBLA0A0D6QR051e-51A0A0D6QR05_ARACU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.13e-48myb domain protein 21